- Recombinant Pectobacterium carotovorum subsp. carotovorum UPF0299 membrane protein PC1_1498 (PC1_1498)
- MyBioSource.com
- Pricing InfoSupplier PageView Company Product Page
- MBS1019017
- 1 mg (E Coli Derived)
- This item requires custom production and lead time is between 5-9 weeks. We can custom produce according to your specifications
- >90%
- Recombinant Protein
- 14,990 Da
- E Coli or Yeast
- 1-135
- UPF0299 membrane protein PC1_1498 (PC1_1498)
Sequence
MRNTFIVCWQYLRAFALIYLCLLAGNAVSALLPFTIPGSIIGMLVLFTLLASQILPAQWVKPGCHLLIRHMALLFVPIGVGVMNYYDLVSQQFGPIVVSCLISTFIVMLVVGFSTQIMQRERAMAGDRTPPKDNE